DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and pebp1

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_998488.1 Gene:pebp1 / 406627 ZFINID:ZDB-GENE-040426-2621 Length:187 Species:Danio rerio


Alignment Length:165 Identity:62/165 - (37%)
Similarity:89/165 - (53%) Gaps:2/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSA-PENYYALLMVDPDVPNAITPTHREFL 102
            |.:.|.|.|........|||..|.||::.| |::|... |...|.|.|.|||.|:...|..||:.
Zfish    21 PAKPLTVKYDSVEIDSLGKVCTPTQVQNRPTSIEWEGCDPSKLYTLAMTDPDAPSRKDPKFREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.::.|.|...|:||.|.||||.||:|:|:|:|..........|...|...|..|:
Zfish    86 HFLVVNVKGNDVSSGCVMSDYVGAGPPKGTGLHRYVWLVYEQSGNISCTERVLTNRSGDNRGKFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            .:.|.|||..|.|:||:.|.::|...||.|.:.::
Zfish   151 IQSFRKKYSLGAPLAGSCFQAEWDNYVPKLYEQLA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 57/145 (39%)
pebp1NP_998488.1 PEBP_euk 23..171 CDD:176644 57/147 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.