DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and a5

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_476998.1 Gene:a5 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster

Alignment Length:184 Identity:67/185 (36%)
Similarity:107/185 (58%) Gaps:0/185 (0%)


  Fly    18 SDTEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYA 82
            :|..|.:||:.::|||:::...|:|.|.:.|...:....||...|.:::.:|.:.|.:.||::|.
  Fly    22 NDENVRRIMKEMEVIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYT 86

  Fly    83 LLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDY 147
            :||:.||.||...|.:|.:|||:|:|:||..:..|.....|.|..|.|.:|..|::.|:|:|.|.
  Fly    87 VLMICPDAPNRENPMYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDK 151

  Fly   148 TKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
            ..||..|:...:..|.|.|:..:|.:||..|.|||||.|.|:|...||.|:|.:
  Fly   152 LDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTL 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 52/144 (36%)
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 52/145 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86935842
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.