DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and a5

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster


Alignment Length:184 Identity:67/184 - (36%)
Similarity:107/184 - (58%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SDTEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYA 82
            :|..|.:||:.::|||:::...|:|.|.:.|...:....||...|.:::.:|.:.|.:.||::|.
  Fly    22 NDENVRRIMKEMEVIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYT 86

  Fly    83 LLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDY 147
            :||:.||.||...|.:|.:|||:|:|:||..:..|.....|.|..|.|.:|..|::.|:|:|.|.
  Fly    87 VLMICPDAPNRENPMYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDK 151

  Fly   148 TKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
            ..||..|:...:..|.|.|:..:|.:||..|.|||||.|.|:|...||.|:|.:
  Fly   152 LDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 52/143 (36%)
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 52/144 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452400
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.