DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and mRpL38

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_511152.2 Gene:mRpL38 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster

Alignment Length:237 Identity:58/238 (24%)
Similarity:94/238 (39%) Gaps:67/238 (28%)


  Fly     9 LKSTRGVHQSDTEVSKIMRSLDVIPDV--------------------IHIG------------PQ 41
            |||.|    ||.::.::.||..:|.|:                    .|.|            |:
  Fly    85 LKSQR----SDKQLEQLARSNKLIIDLDKVQRTYVKTTGQHDLRLVADHYGIFEHLFGSAYFVPR 145

  Fly    42 EFLNVTYH---GHLA-AHCGKVLEPMQVRDEPSVKW----------PSAPENYYALLMVDPDVPN 92
            ..||::|.   ..|| .:.|.|::|.:....|.:.:          .:..:.|:.|:..:||.  
  Fly   146 VPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDA-- 208

  Fly    93 AITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQR---DYTKF---- 150
            ..|....|.|||.:.|||...::.|.|...|:...|.:|.|..|.||:||||:   |...:    
  Fly   209 HYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGSYQLAA 273

  Fly   151 -DFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAG-NFFTSQW 190
             |:..|.|.:      |.|..|.::::.....|| .|:.:.|
  Fly   274 ADYGNLEKRT------FSTLDFYRQHQEQLTPAGLAFYQTNW 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 44/167 (26%)
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 44/169 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86933306
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.