DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and SPBC2F12.10

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:SPBC2F12.10 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:192 Identity:43/192 - (22%)
Similarity:80/192 - (41%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DTEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWP-------SA 76
            |:.:.....|:||   .:...|:...::|        .|.:| |..|    :||.|       :.
pombe   120 DSGIGSFSPSVDV---QLGFNPENNDSIT--------PGTIL-PSTV----TVKTPWLSVLPFNC 168

  Fly    77 PENYYALLMVDPDVPNAITPTHREFLHWMVLNIP---GNLLALGDVRVGYMGATPL--KGTGTHR 136
            .:|:|:::.:|.||||..|.......:|::.|||   ...:.:...:..:....|:  :|...||
pombe   169 KKNHYSVITLDLDVPNYETNRFETHCNWLLTNIPIEASKRVPIDTSKAFFQYRPPIVHRGEDKHR 233

  Fly   137 FVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLI 198
            .:.|:.:|    |.....:|.:::. |..|:...|...|.. .||..:.:.|.|..|..:|:
pombe   234 ILTLVLRQ----KSSSISIPSNALV-RERFDLSEFCSIYDL-EPVGAHLWRSGWDSDAVALL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 34/155 (22%)
SPBC2F12.10NP_001342831.1 PEBP_euk 130..279 CDD:176644 37/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.