DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and CG30060

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_725293.1 Gene:CG30060 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster

Alignment Length:174 Identity:60/175 (34%)
Similarity:94/175 (54%) Gaps:10/175 (6%)


  Fly    22 VSKIMRSL---DVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYAL 83
            |.|::..|   .|||.:....|.:.::|.|...:....|.::...:...:|.:::.:.||:|:.|
  Fly    11 VEKLVTELKRHHVIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTL 75

  Fly    84 LMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYT 148
            :|||.|||   ...:.|:|.|||.||||..:|:|...|.|.....:.|:..||.|||.:||  |.
  Fly    76 MMVDLDVP---PDNNTEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQ--YL 135

  Fly   149 KFDFPK--LPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQW 190
            :.||.:  :|:...|||..|....||:||..|:|:|.||:..:|
  Fly   136 ELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVEW 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 52/146 (36%)
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 52/148 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4806046
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1615
Isobase 1 0.950 0 Normalized mean entropy S1728
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.