DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and CG30060

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster


Alignment Length:174 Identity:60/174 - (34%)
Similarity:94/174 - (54%) Gaps:10/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSKIMRSL---DVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYAL 83
            |.|::..|   .|||.:....|.:.::|.|...:....|.::...:...:|.:::.:.||:|:.|
  Fly    11 VEKLVTELKRHHVIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTL 75

  Fly    84 LMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYT 148
            :|||.|||   ...:.|:|.|||.||||..:|:|...|.|.....:.|:..||.|||.:||  |.
  Fly    76 MMVDLDVP---PDNNTEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQ--YL 135

  Fly   149 KFDFPK--LPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQW 190
            :.||.:  :|:...|||..|....||:||..|:|:|.||:..:|
  Fly   136 ELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVEW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 52/145 (36%)
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466596
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I473
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
98.950

Return to query results.
Submit another query.