DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Pbp2

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001099226.1 Gene:Pbp2 RGDID:621707 Length:187 Species:Rattus norvegicus

Alignment Length:165 Identity:68/166 (41%)
Similarity:95/166 (57%) Gaps:2/166 (1%)


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSA-PENYYALLMVDPDVPNAITPTHREFL 102
            ||..|.|||.|...:..|:||.|.||::.| |:.|... |...|.|::.|||.|:...|.:||:.
  Rat    21 PQHLLRVTYAGAEVSELGQVLTPTQVKNRPSSITWDGLDPGKLYTLILTDPDAPSRKEPIYREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.::.|.|...|:|:.|.||||.||:|:|:|:|....|.|.|.|...|...|..|:
  Rat    86 HFLVVNMKGNDISSGKVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLKCDEPILTNRSGNQRGKFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            ...|.|||..|.||||..:.::|...||.|.|.:|
  Rat   151 AAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 60/146 (41%)
Pbp2NP_001099226.1 PEBP_euk 23..171 CDD:176644 60/148 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86924215
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.