DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Pebp1

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_061346.2 Gene:Pebp1 MGIID:1344408 Length:187 Species:Mus musculus

Alignment Length:165 Identity:65/166 (39%)
Similarity:90/166 (54%) Gaps:2/166 (1%)


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSA-PENYYALLMVDPDVPNAITPTHREFL 102
            ||..|.|.|.|......||||.|.||.:.| |:.|... |...|.|::.|||.|:...|..||:.
Mouse    21 PQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.::.|.|...|:|:.|..|||.||:|:|:|:|......|.|.|...|...|..|:
Mouse    86 HFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            .:.|.|||..|.||||..:.::|...||.|.:.:|
Mouse   151 VETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 58/146 (40%)
Pebp1NP_061346.2 PEBP_euk 25..171 CDD:176644 58/146 (40%)
Interaction with RAF1. {ECO:0000250} 93..134 16/41 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.910

Return to query results.
Submit another query.