DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Y69E1A.5

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_502042.1 Gene:Y69E1A.5 WormBaseID:WBGene00013477 Length:172 Species:Caenorhabditis elegans

Alignment Length:175 Identity:50/176 (28%)
Similarity:89/176 (51%) Gaps:12/176 (7%)


  Fly    20 TEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSA-PENYYAL 83
            :::|......::.|.:|...|::.|::.:.| :....|..::...:::.|....|.| ||:.|.:
 Worm     2 SDISAAFAQHEITPKIIENAPKQKLHLCWDG-IQVEPGMTMQVRNLKNAPRWALPGADPESIYTV 65

  Fly    84 LMVDPDVPNAITPTHREFLHWMVLNIPGNLLA----LGDVRVGYMGATPLKGTGTHRFVFLLYKQ 144
            ||:|||..:...|:..|:|||:|.|||.:.:.    .|..::.|....|...|..||:|.|:::.
 Worm    66 LMIDPDNLSRKNPSVAEWLHWLVCNIPASNIIDGINGGQHQMAYGSPAPGPRTDLHRYVILMWEH 130

  Fly   145 RDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
            .. .:...||     ...|:.|..|:|.:|.:.|.|:|||||.:|
 Worm   131 AG-RRISVPK-----PSSRAKFNVKQFIEKNKLGDPIAGNFFLAQ 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 45/149 (30%)
Y69E1A.5NP_502042.1 PEBP_euk 25..168 CDD:176644 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.