DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and F40A3.3

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001300105.1 Gene:F40A3.3 WormBaseID:WBGene00018218 Length:226 Species:Caenorhabditis elegans

Alignment Length:200 Identity:75/200 (38%)
Similarity:113/200 (57%) Gaps:5/200 (3%)


  Fly     4 APSLSLKSTRGVHQSDTEVSKIMRSLDVIPDVIHIG-PQEFLNVTYHGHLAAHCGKVLEPMQVRD 67
            |.:.|.:..||:   .|..::.....:|||||:... |.:.::|.::..:.|:.|.||.|.||:|
 Worm    28 AATTSARFQRGL---ATMAAEAFTKHEVIPDVLASNPPSKVVSVKFNSGVEANLGNVLTPTQVKD 89

  Fly    68 EPSVKWPSAPENYYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGT 132
            .|.|||.:.|...|.|:..|||.|:...||:||:.||:|:|||||.:|.||....|:||.|...|
 Worm    90 TPEVKWDAEPGALYTLIKTDPDAPSRKEPTYREWHHWLVVNIPGNDIAKGDTLSEYIGAGPPPKT 154

  Fly   133 GTHRFVFLLYKQRDYTK-FDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPS 196
            |.||:|:|:|||....: .:..:|...|...|.|::...|..|::.|.||.||.|.:::...||.
 Worm   155 GLHRYVYLIYKQSGRIEDAEHGRLTNTSGDKRGGWKAADFVAKHKLGAPVFGNLFQAEYDDYVPI 219

  Fly   197 LIKAI 201
            |.|.:
 Worm   220 LNKQL 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 60/145 (41%)
F40A3.3NP_001300105.1 PEBP_euk 64..211 CDD:176644 60/147 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4806069
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.850

Return to query results.
Submit another query.