powered by:
Protein Alignment CG17917 and C56G2.4
DIOPT Version :9
Sequence 1: | NP_649642.1 |
Gene: | CG17917 / 40778 |
FlyBaseID: | FBgn0037431 |
Length: | 211 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498385.2 |
Gene: | C56G2.4 / 175894 |
WormBaseID: | WBGene00016979 |
Length: | 538 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 19/56 - (33%) |
Similarity: | 28/56 - (50%) |
Gaps: | 4/56 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 AITPTHREFLHWMVLNIP-GNLLAL---GDVRVGYMGATPLKGTGTHRFVFLLYKQ 144
||...|...|||:.::|| .||.|. |..:..|:...|.|.:..|.::|:|..|
Worm 365 AIIDAHHGHLHWLEVDIPAANLNAANGNGLTKADYVPLIPKKPSTCHSYLFVLLAQ 420
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17917 | NP_649642.1 |
PEBP_euk |
44..188 |
CDD:176644 |
19/56 (34%) |
C56G2.4 | NP_498385.2 |
PEBP |
<374..454 |
CDD:294157 |
16/47 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11362 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.