DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and C56G2.4

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_498385.2 Gene:C56G2.4 / 175894 WormBaseID:WBGene00016979 Length:538 Species:Caenorhabditis elegans


Alignment Length:56 Identity:19/56 - (33%)
Similarity:28/56 - (50%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 AITPTHREFLHWMVLNIP-GNLLAL---GDVRVGYMGATPLKGTGTHRFVFLLYKQ 144
            ||...|...|||:.::|| .||.|.   |..:..|:...|.|.:..|.::|:|..|
 Worm   365 AIIDAHHGHLHWLEVDIPAANLNAANGNGLTKADYVPLIPKKPSTCHSYLFVLLAQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 19/56 (34%)
C56G2.4NP_498385.2 PEBP <374..454 CDD:294157 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.