DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and C56G2.4

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_498385.2 Gene:C56G2.4 / 175894 WormBaseID:WBGene00016979 Length:538 Species:Caenorhabditis elegans


Alignment Length:56 Identity:19/56 - (33%)
Similarity:28/56 - (50%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 AITPTHREFLHWMVLNIP-GNLLAL---GDVRVGYMGATPLKGTGTHRFVFLLYKQ 144
            ||...|...|||:.::|| .||.|.   |..:..|:...|.|.:..|.::|:|..|
 Worm   365 AIIDAHHGHLHWLEVDIPAANLNAANGNGLTKADYVPLIPKKPSTCHSYLFVLLAQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 19/56 (34%)
C56G2.4NP_498385.2 PEBP <374..454 CDD:469671 16/47 (34%)

Return to query results.
Submit another query.