DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and PEBP4

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_659399.2 Gene:PEBP4 / 157310 HGNCID:28319 Length:227 Species:Homo sapiens


Alignment Length:148 Identity:49/148 - (33%)
Similarity:71/148 - (47%) Gaps:10/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVR----VGYMGAT 127
            ||.||:|.|.:. .|.|:|||||.|:...|..|.:.||:|.:|.|..|..|.::    ..|...:
Human    76 EPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPS 140

  Fly   128 PLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSP 192
            |...:|.||:.|.:|.|....   ...|||.: |.|..::..||..::..|.|.|...|.:|...
Human   141 PPAHSGFHRYQFFVYLQEGKV---ISLLPKEN-KTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQ 201

  Fly   193 DVPSLIKAISHNARQVAH 210
            |.|:| :|....|.:..|
Human   202 DSPTL-QAPRERASEPKH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 42/124 (34%)
PEBP4NP_659399.2 PEBP_euk 46..197 CDD:176644 42/124 (34%)
Important for secretion. /evidence=ECO:0000269|PubMed:27033522 188..227 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 6/18 (33%)

Return to query results.
Submit another query.