DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and LOC100497751

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002938131.1 Gene:LOC100497751 ID: Length:185 Species:Xenopus tropicalis

Alignment Length:163 Identity:54/164 (33%)
Similarity:85/164 (52%) Gaps:1/164 (1%)


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLH 103
            |:..|.|.:........|:||.|.||:..|:::|.|...: .|.::..|||||:.......|:.|
 Frog    21 PKYPLKVAFGSVCVEELGQVLTPTQVQHCPNIEWESMDSSKLYTVIFTDPDVPSRKECHLGEWHH 85

  Fly   104 WMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFET 168
            ::.:|:.||.|:.|.:...|:|:.|.||||.||:..|:|:|....:.....|...|.:.|..|:.
 Frog    86 FLAVNVKGNDLSSGCILTAYVGSGPGKGTGLHRYTILVYEQAGRVQCTERILGNTSAEHRGKFKA 150

  Fly   169 KRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
            ..|.|||:...|:||..|.::|...||.|.|.:
 Frog   151 SEFRKKYKLAAPIAGTCFQAEWDDHVPKLYKQL 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 48/145 (33%)
LOC100497751XP_002938131.1 PEBP_euk 24..170 CDD:176644 48/146 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.