DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and pebp1

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002938131.1 Gene:pebp1 / 100497751 XenbaseID:XB-GENE-22069563 Length:185 Species:Xenopus tropicalis


Alignment Length:163 Identity:54/163 - (33%)
Similarity:85/163 - (52%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLH 103
            |:..|.|.:........|:||.|.||:..|:::|.|...: .|.::..|||||:.......|:.|
 Frog    21 PKYPLKVAFGSVCVEELGQVLTPTQVQHCPNIEWESMDSSKLYTVIFTDPDVPSRKECHLGEWHH 85

  Fly   104 WMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFET 168
            ::.:|:.||.|:.|.:...|:|:.|.||||.||:..|:|:|....:.....|...|.:.|..|:.
 Frog    86 FLAVNVKGNDLSSGCILTAYVGSGPGKGTGLHRYTILVYEQAGRVQCTERILGNTSAEHRGKFKA 150

  Fly   169 KRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
            ..|.|||:...|:||..|.::|...||.|.|.:
 Frog   151 SEFRKKYKLAAPIAGTCFQAEWDDHVPKLYKQL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 48/144 (33%)
pebp1XP_002938131.1 PEBP_euk 24..170 CDD:176644 48/145 (33%)

Return to query results.
Submit another query.