DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi23

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster

Alignment Length:208 Identity:40/209 (19%)
Similarity:83/209 (40%) Gaps:48/209 (23%)


  Fly    50 CFHANAMH----CLKEKVLTYLDTVANV--EEEVSGRALGDDV---------IDKVIVDRLGRIL 99
            ||.:.::|    .:....::..|.|..|  ..........||.         .|::.|. |.:.|
  Fly    57 CFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDLKHLTWFDQLAVS-LAKGL 120

  Fly   100 NTNEMRLQLPQTFFAGSVV-TYRSDRGFDLELPKDEGRAE-KKNKDKLFLPLLLLMKFKLKVIMP 162
            .|:.:::.|      |.:. .|.|.   |...|...|.|. ::::..:.:.::..:.....:::|
  Fly   121 TTHTLQVNL------GKLTERYLSS---DTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVP 176

  Fly   163 ILLALIGLKATKALILSKIAIKLV------------LGFLIYNLI-QKLGG-------MKMNMVP 207
            :...::.:.:.|||:|:|:|:.|.            |.:.:|::. :.|||       .....||
  Fly   177 MGFQMLSIVSGKALLLAKMALLLASINGLKRVANNGLHYGLYHVPGEHLGGYYDRGDVSHPRNVP 241

  Fly   208 MPAPV-PASEYGV 219
            :|..| |..:.|:
  Fly   242 IPVAVAPTLDMGL 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 16/81 (20%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.