| Sequence 1: | NP_649641.1 | Gene: | Osi20 / 40777 | FlyBaseID: | FBgn0037430 | Length: | 280 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649640.1 | Gene: | Osi19 / 40776 | FlyBaseID: | FBgn0037429 | Length: | 266 | Species: | Drosophila melanogaster | 
| Alignment Length: | 300 | Identity: | 62/300 - (20%) | 
|---|---|---|---|
| Similarity: | 110/300 - (36%) | Gaps: | 94/300 - (31%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     8 LLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHA-NAMHCLKEKVLTYLDT-- 69 
  Fly    70 ------VANVEEEVSG---------RALGDDVIDKVIVDRLGRILNTNEMRLQLP-----QTFFA 114 
  Fly   115 GSVVTYR-----------SDRGFDLELPKDEGRAEKKNKD----KLFLPLLLLMKFKLKVIMPIL 164 
  Fly   165 LALIGLKATKALILSKIAIKLVLGFLIYNLIQKLG----------------GMKMNMVPMPAPVP 213 
  Fly   214 ASEYGVPSTTASSYDPSSWEPMSGGPYARWDSQNLAYSSY 253 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Osi20 | NP_649641.1 | DUF1676 | <73..141 | CDD:285181 | 17/92 (18%) | 
| Osi19 | NP_649640.1 | DUF1676 | 57..163 | CDD:285181 | 22/109 (20%) | 
| DUF3671 | <152..216 | CDD:289205 | 18/63 (29%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21879 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||