DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi15

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster

Alignment Length:191 Identity:49/192 (26%)
Similarity:77/192 (40%) Gaps:31/192 (16%)


  Fly    11 FGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLDTVANVEE 75
            |.|.:||.:....|.|         :.|.|.....:|      |.::.|..:....|.....::.
  Fly     5 FVCVVLLASLVCGSMA---------LPSQDNTERDLV------NMLNRLDSEESVALFGGLRIDR 54

  Fly    76 EVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRA--- 137
            ..|||:.|.....:...||..|.|.|:|:.|.     |:|......|:..:       .|||   
  Fly    55 SESGRSFGASKAVESFEDRAERYLETHELNLS-----FSGDEQDENSENEY-------TGRAMDE 107

  Fly   138 -EKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALILSKIAIKLVLGFLIYNLIQK 197
             ..|...|:.|||||.:|.|..|::.|:..:|...:.|||.:|.:|:.|.......:|:.|
  Fly   108 SRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDLLAK 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 18/72 (25%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.