DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi14

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster

Alignment Length:285 Identity:68/286 (24%)
Similarity:119/286 (42%) Gaps:65/286 (23%)


  Fly     8 LLAFGCALLLVASTSVSGAAIENAVTPRIHSSDEL--ISTIVDKCFHANAM-HCLKEKVLTYLDT 69
            :.|..|..||.||...:..::::   .::...:.|  .:..:..|..::.| .||..|.:|.|:.
  Fly     3 VFAIACVTLLAASCVFAAPSVQD---NQVEGDNTLGRAARYLGACLESDDMATCLAVKGITALNR 64

  Fly    70 VA--NVEEEVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQT----------FFAGSVVTYRS 122
            .|  |..|..||.....|....  |.|.|:.::..::..:|||.          ....|...:.|
  Fly    65 AARSNNIELASGVTFQRDPASP--VSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFLS 127

  Fly   123 DRGFDLELPK----------DEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALI 177
            ....:.:||.          ||||.:.|   |:..|:.|.:..||..::|::|..:.|...||:|
  Fly   128 THNLEFKLPAETTQQVARALDEGRGKIK---KMLGPVALAIGAKLFAVIPLVLGFLALLTFKAVI 189

  Fly   178 LSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPSSWE-PMSGG--- 238
            ::|:|..|.   ::....:.|||.            .:::| .::.|.:|:.::|. |.|.|   
  Fly   190 VAKLAFFLA---ILVGGSRLLGGF------------GNKFG-GNSFAGAYNSNAWSAPASAGWSS 238

  Fly   239 ------PYAR------WDSQNLAYS 251
                  ||||      .|:|.|||:
  Fly   239 GASSSYPYARSISEDGSDAQQLAYA 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 19/88 (22%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 23/103 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.