DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi12

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649631.1 Gene:Osi12 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster

Alignment Length:305 Identity:70/306 (23%)
Similarity:119/306 (39%) Gaps:107/306 (35%)


  Fly     7 SLLAFGCALLLVASTSVSGAAIENAVTPRIHSSDE-----LISTIVDKCFHANA--MHCLKEKVL 64
            |||    ::|.:||:  .|||.|...:|...|..:     .:..:.|:|..|.|  :.|||:|.:
  Fly    13 SLL----SVLFLASS--CGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAI 71

  Fly    65 TYLDTVA-----NVEEEV---------------------------SGRALGDDVIDKVIVDRLGR 97
            :::|.:|     ||.|.:                           |.|   |..:..::::||..
  Fly    72 SFIDRLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDR---DAKLTNMLIERLSY 133

  Fly    98 ILNTNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMP 162
            ..|.:.:::..|:      :.:....||.      :|||.:.|   |:...:::.|..|:..::|
  Fly   134 FFNGHSLQVSFPK------LTSDEIGRGL------EEGRGKMK---KMMGMMMMGMAMKMMGMIP 183

  Fly   163 ILLALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSY 227
            |.:..:.:.|.||||:||||: |:.|.:         |:|..|                :..||.
  Fly   184 IAMGALYILAGKALIISKIAL-LLAGII---------GLKKLM----------------SGKSSG 222

  Fly   228 DPSSWEPMSGGPYARWDS------------------QNLAYSSYH 254
            ..|.|....||....|.|                  |.|||.::|
  Fly   223 GSSGWSSGGGGGGGGWSSGGGGGGGGGWDRRSLTEAQELAYRAHH 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 15/95 (16%)
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 15/100 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.