DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi10

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_731058.1 Gene:Osi10 FlyBaseID:FBgn0037417 Length:576 Species:Drosophila melanogaster

Alignment Length:228 Identity:57/229 (25%)
Similarity:93/229 (41%) Gaps:59/229 (26%)


  Fly    15 LLLVASTSVSGA-----------AIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLD 68
            ||||:...|.|:           .:..:..|:|           .:|...:|::.:::  |...|
  Fly     8 LLLVSFHQVIGSDFSAMSLEFKQCVRGSQKPKI-----------GECLGRSALNFIQK--LDESD 59

  Fly    69 TVANVEEEVS-----------GRALGDDVID-KVIVDRLGRILNTNEMRLQL----PQTFF---- 113
            .|..||:.|:           ...|..|.:| :.|::..|.::....|...:    |...|    
  Fly    60 NVKFVEDFVTVKSETAAVRSLSNVLDTDPVDFRGILENAGAVMGQRSMEWHMDGLYPGLMFKIGP 124

  Fly   114 ---AGSVVTY------RSDRGFDLELPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIG 169
               |.||..:      :.:|.|..|.| ..||...|   :..||.||.:||.|..::|::.|.|.
  Fly   125 TADANSVAEFVLDGAAQGERQFGFEDP-STGRVLTK---QYLLPFLLGLKFNLVALVPLIFAGIC 185

  Fly   170 LKATKALILSKIAIKLVLGFL-IYNLIQKLGGM 201
            |...|:|.|.|:|| .|..|| :..::..|||:
  Fly   186 LLLKKSLFLVKLAI-YVSSFLGLGGIVGGLGGL 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 21/97 (22%)
Osi10NP_731058.1 DUF1676 42..203 CDD:311725 44/168 (26%)
DUF1676 355..487 CDD:311725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.