DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi9

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster

Alignment Length:273 Identity:68/274 (25%)
Similarity:121/274 (44%) Gaps:69/274 (25%)


  Fly     8 LLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLD---- 68
            :..|.|...|:|||:.:.:..::.:|..:        .:|..|...:.:.|:||:.|.|.|    
  Fly     1 MFKFVCLFALIASTAAATSEADSLLTSAL--------KMVKDCGERSMVLCMKERALHYFDAENG 57

  Fly    69 --------TVANVEEEVSGRALG-----DDV------IDKVIVDRLGRILNTNEMRLQLPQTFFA 114
                    .:...:|...||:|.     ::|      :|.::|:|:.|...|:.::.::|:    
  Fly    58 DVRLTEGIALVKTDEIPVGRSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPK---- 118

  Fly   115 GSVVTYRSDRGFDLELPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALILS 179
                    |...|::...:|.|.:||.|.|..:|||:|.|.|:..::|:.:..:.|.:.|||::.
  Fly   119 --------DSIQDMQRALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIG 175

  Fly   180 KIAIKLVLGFLIYNLIQKLGGMKMN--MVPMPAPVPASEYG--VPSTTASSYDPSSWEPMSGGPY 240
            |||: |:.|  |..|.:.|...|.|  :|..|.......||  :||      |.|          
  Fly   176 KIAL-LLSG--IIGLKKLLESKKENYEVVAHPHYEHEHSYGRSLPS------DDS---------- 221

  Fly   241 ARWDSQNLAYSSY 253
               .:|.|||::|
  Fly   222 ---QAQQLAYAAY 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 17/79 (22%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.