DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi8

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster

Alignment Length:289 Identity:62/290 (21%)
Similarity:109/290 (38%) Gaps:97/290 (33%)


  Fly    27 AIENAVTPRIHSSD------------ELISTIVDKCFHANAMHCLKEKVLTYLDTV--------- 70
            ::.:|..|::.:|:            .::..|..:|...|...|||.|:||.|:..         
  Fly    33 SLSSAPRPQVQNSNPGMGSTGLWKDMSMVYRIYQQCSGDNMSVCLKVKLLTGLEKAFRSAKSLSL 97

  Fly    71 --------ANVEEEVSGRA----------------LGDDVIDKVIVDRLGRILNTNEMRLQLPQT 111
                    :..|.|.:.||                ..:.|::.:|:.|:|..|..:.::::    
  Fly    98 MEGIQFVSSGGESEETKRAPISEKDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVK---- 158

  Fly   112 FFAGSVVTYRSDRGFDLELPKDEGRAEKKNKDK---LFLPLLLLMKFKLKVIMPILLALIGLKAT 173
                          ||.|....|||.:|:.|..   :.:||||     ...|:|:....:.:.|.
  Fly   159 --------------FDNEANSVEGRKKKEKKGNGAMIMIPLLL-----GGTIVPLAYGALAMLAG 204

  Fly   174 KALILSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEPMSGG 238
            ||||:||:|:.|.....|..|:...||.|                     .||::    ..:|.|
  Fly   205 KALIVSKLALVLASIIGIKKLLSGGGGGK---------------------ESSHE----VVVSSG 244

  Fly   239 PYARWDSQ-NLAYSSYHPSSSSSYSSGSS 266
            .::.|..: :.|||.:.|::..|..|..|
  Fly   245 GHSGWGRELDTAYSGWKPAAKESAGSAKS 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 16/84 (19%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 15/102 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.