DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi7

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster

Alignment Length:305 Identity:68/306 (22%)
Similarity:127/306 (42%) Gaps:80/306 (26%)


  Fly     9 LAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLDTVANV 73
            :.||...|:..|.::............|...::::.:|...|...:::.|:|.|:.:::|.|...
  Fly     6 VTFGVLCLVALSAALPAEETRGHARNAIGGENDIMDSIYSDCLRKDSVSCVKYKLFSFVDKVLGA 70

  Fly    74 -------------------EEEVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGSVVT 119
                               ::|.:....||:..:.:.::|:...||::.::::|.    ...:|.
  Fly    71 RDQFALTEGVTVVRSPDAPQQEAARSISGDESFESLALNRISSFLNSHTIKVELK----GADIVQ 131

  Fly   120 YRSDRGFDLE-------------LPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLK 171
            ..|..|..||             .| :|.|.:||...|:..|:|.|:..|...::|:||..|.|.
  Fly   132 AVSSTGRALEDASESLFGSNDPNAP-EESRGKKKKAAKILGPILALVALKAAALLPLLLGAIALI 195

  Fly   172 ATKALILSKIAIKL--VLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEP 234
            |.|||::.|||:.|  |:|      ::||...:.::                    :|:      
  Fly   196 AGKALLIGKIALVLSAVIG------LKKLLSQEKHV--------------------TYE------ 228

  Fly   235 MSGGPYARWDSQNLAYSSYHPSSSSSYSSGSSSGSSGSSSSYSSS 279
            :...|:         :||.|.:|..||.||.|:.:..||:||.||
  Fly   229 VVAHPH---------HSSSHSTSHDSYGSGYSADAGASSASYGSS 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 17/100 (17%)
Osi7NP_649626.1 DUF1676 68..172 CDD:285181 18/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.