DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi4

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster

Alignment Length:159 Identity:42/160 (26%)
Similarity:64/160 (40%) Gaps:31/160 (19%)


  Fly   135 GRAEKKNKDK----LFLPL-LLLMKFKLKVIMPILLALIGLKATKALILSKIAIKLVLGFLIYNL 194
            ||...:::||    :|:|: |....|...:   :....:||...|||||||||..:....||..|
  Fly   201 GRRRHQHQDKKQFQMFIPMYLAATTFGWTM---VAAKAVGLLTLKALILSKIAFVVAAIVLIKKL 262

  Fly   195 IQKLGGMKMNMVPMPAP--VPASEYGVP-----STTASSYDPSSWE--PMSGGPYARWDSQNLAY 250
            :.......|...|...|  :|   ||:.     :..:....|||..  .|:||       ..|..
  Fly   263 MDNASEKMMYQFPEQTPYMMP---YGMDYPLHGAEISPEMYPSSLHHLAMAGG-------GQLPG 317

  Fly   251 SSYHPS----SSSSYSSGSSSGSSGSSSS 275
            ...||.    |:.|:...:...|.||:::
  Fly   318 HPGHPGLESLSAESHLHSAQVSSDGSNNT 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 2/6 (33%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.