DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi3

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster

Alignment Length:307 Identity:69/308 (22%)
Similarity:119/308 (39%) Gaps:81/308 (26%)


  Fly     3 FRSTSLLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVL--- 64
            |:..:||||...|:....:......:..:.:.|.:..|.|::.:...|...:...|...|:.   
  Fly     4 FKVCALLAFCFVLVSARGSKRRDGTVTISESERKNIEDFLLAKLKQNCRQEDDRACKMVKMSIVM 68

  Fly    65 --TYLDTVANV-----------------EEEVS---GRALGDD--VIDKVIVDRLGRILNTNEMR 105
              .||:|..::                 :.||:   .|::|.|  ....::.::|.:.:.:..:|
  Fly    69 NHLYLNTRIDLGDRFKVTENGNISMVPDDPEVNQLLSRSMGSDEETFALLMANKLWKFIRSRSLR 133

  Fly   106 LQLPQTFFAGSVVTYRSDRGFDLEL-----PKD---EGRAEKKNKDKLFLPLLLLMKFKLKVIMP 162
            .:    |...:.....||....|.|     |.:   |||.:.||..    |||::|..|..::..
  Fly   134 YK----FSENTDFVINSDPEGSLNLGVSVRPLEALQEGRGKMKNMG----PLLMMMAAKTGMVGA 190

  Fly   163 ILLALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSY 227
            :||..:.|.|.||||:||||  |:|..:|  .::||...|..:|.:|               |.:
  Fly   191 LLLKGLFLLAGKALIVSKIA--LLLAVII--SLKKLLSSKKTIVEVP---------------SHH 236

  Fly   228 D--PSSWEPMSGG-----------------PYARWDSQNLAYSSYHP 255
            |  .|.|.....|                 .:.:..:||:|||...|
  Fly   237 DSYSSGWSRAFDGFVEGLVDVPADILAKEVQHQQEQAQNMAYSGQQP 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 17/98 (17%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.