DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi2

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster

Alignment Length:305 Identity:71/306 (23%)
Similarity:113/306 (37%) Gaps:86/306 (28%)


  Fly    37 HSSDELISTIVDKCFHANAMHCLKEKVLTYLDTVANVEE-------------EVSGRAL------ 82
            :.:|..::.....|...:...|.|.:.|...|.:...::             |...|:|      
  Fly    78 NDNDPFLARTNSNCLGGDLSECFKTQALNTFDEIFFKDQYKLSDFARVVRLPETQQRSLLQEPFE 142

  Fly    83 ------GDD----VIDKVIVDRLGRILNTNEMRLQLPQTF---------FAGSVVTYRSDRGFDL 128
                  |||    .:.|..:.|..|.:.:..:.::.|:..         |.|      :|...:|
  Fly   143 YSEEPRGDDDEWNQLLKYGLRRAERFIKSTALEVEWPEELTEAGRYEARFIG------NDIDGEL 201

  Fly   129 ELPKDEGRA---EKKNKDKLFLPLLLLMK-FKLKVI--MPILLALIGLKATKALILSKIAIKLVL 187
            :|..|..||   .:|...|:.:||||::| ||||::  :|.:|.:.|||.    ||...||.|..
  Fly   202 DLIDDGQRAGHFSRKKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLKK----ILGLAAIVLPG 262

  Fly   188 GFLIYNLIQKLGGM-------------KMNMVPMPAPVPASEYGVPSTTASSY--DPSSWEPMSG 237
            .|..:.|.:..||:             ..|..|        ||......|::|  ....:|...|
  Fly   263 LFAYFKLCRPPGGVGGAFGGGLSGLFGGKNTFP--------EYNPQGVGAATYYHHHEHFEGGHG 319

  Fly   238 ---GPYARWD-SQNLAYSSYHPSSSSSYSSGSSSGS--SGSSSSY 276
               |||.|.: |....|:.|:   |.||......|.  .|:|.|:
  Fly   320 GAPGPYYRQEPSFAKPYTDYY---SKSYQGQQVQGQQVGGNSVSF 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 19/109 (17%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 21/122 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.