DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi20 and Osi21

Sequence 1:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster

Alignment Length:318 Identity:69/319 (22%)
Similarity:125/319 (39%) Gaps:107/319 (34%)


  Fly    15 LLLVASTSVSGAAIENAVTP--RIHSSDE---------------------LISTIVDKCFHAN-A 55
            |||:|..    |::..||||  |.||:.|                     |:..:.|.|...| .
  Fly     7 LLLLALV----ASVSTAVTPRRRRHSAVESATTSSPGDWGTAWGLGPEMALVRRVYDDCQDKNDF 67

  Fly    56 MHCLKEKVLTYL------DTVANVE------------EEVSG-----RALGD-DVIDKVIVDRLG 96
            :.|||:|.|..|      |::..|:            |.:.|     |..|: ..||:.::.:..
  Fly    68 IGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSPIDRALLSKAD 132

  Fly    97 RILNTNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRAEKKNKD----KLFLPLLLLMKFKL 157
            :::.|:.:::.:.    .|         |.:..:.::.|..:||:|:    |..:..||.   .:
  Fly   133 KLMRTHTLKIDMD----VG---------GGEDSVGREHGHKKKKHKEGGHIKYVVAALLT---AM 181

  Fly   158 KVIMPILLALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPST 222
            .:..|:.|..:...|.|||::||:|: .:.|.:   .::||                        
  Fly   182 GIAGPLGLKALAAIAGKALVISKVAL-TIAGII---ALKKL------------------------ 218

  Fly   223 TASSYDPSSWEPMSGGPYARWDSQNLAYSSYHPSSSSSYSSGSSSGSSGSSSSYSSSS 280
              .|:|.|  |..|...:|...::...| ...|.|.:|.::|  :|..|.:::..|||
  Fly   219 --FSHDHS--EETSFQVHAGEHNRRNTY-VIRPVSKTSAAAG--AGGVGVTAAGGSSS 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 13/86 (15%)
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 12/86 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.