DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi23

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster

Alignment Length:273 Identity:60/274 (22%)
Similarity:107/274 (39%) Gaps:54/274 (20%)


  Fly     4 LLLVIVGVAAL--VAAGQAAGGST--EKMQRLIAEEQNKCASG--QDSMACIKERAMRFVDNVMS 62
            |:..::||..:  .|||:.....:  .:|::|.::.::...||  |...:|.:.|::...:.:||
  Fly     7 LVTFLLGVILVDRYAAGEDLADKSWISQMKKLRSDLRDCYQSGIHQSLWSCFRSRSLHIFEGIMS 71

  Fly    63 KDSFQVSNLEVRSNGEKTTPINEARASSADGFLDAIENYIRGHDVSMD---LPLADAKVTVSARN 124
            .....:      .:|.:..    |..:|.|       |..|..|...|   |...|......|:.
  Fly    72 SPEISI------YDGVRLV----AAPNSTD-------NATRPDDERKDLKHLTWFDQLAVSLAKG 119

  Fly   125 LVNNQLSLNL------QLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITV 183
            |..:.|.:||      .|:.|..:......||         .::||...:...:..:..|.|| :
  Fly   120 LTTHTLQVNLGKLTERYLSSDTSNPDPVGSAR---------VRRHRYNMIITMMFGVTALGAI-L 174

  Fly   184 IPMAIGILKIKAFNALALGFFSFIVSVGLAIFQLCKKIAHD--HHHTAHITAH---GPWDGRTFS 243
            :||...:|.|.:..||.|...:.:    ||.....|::|::  |:...|:...   |.:|....|
  Fly   175 VPMGFQMLSIVSGKALLLAKMALL----LASINGLKRVANNGLHYGLYHVPGEHLGGYYDRGDVS 235

  Fly   244 ---SVPAPVVEQP 253
               :||.||...|
  Fly   236 HPRNVPIPVAVAP 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 21/115 (18%)
DUF3671 <152..216 CDD:289205 14/64 (22%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.