DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi14

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster

Alignment Length:279 Identity:56/280 (20%)
Similarity:99/280 (35%) Gaps:58/280 (21%)


  Fly     9 VGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSFQVSNLEV 73
            |..|..|...|..|.:|  :.| .|.....|....|...|:..:.:..::.....::.:::: .|
  Fly    17 VFAAPSVQDNQVEGDNT--LGR-AARYLGACLESDDMATCLAVKGITALNRAARSNNIELAS-GV 77

  Fly    74 RSNGEKTTPINEARASSADGFLDAIENYIRGHDVSMDLP---------LADAKVTVSARNLVNNQ 129
            ....:..:|::....|.::            .||..:||         |.|..|:.:|..|..:.
  Fly    78 TFQRDPASPVSRTGKSMSE------------QDVYAELPQNADERTGRLVDLAVSSAADFLSTHN 130

  Fly   130 LSLNLQLNGDDG-----DEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIG 189
            |...|.......     |||     |||            ::|:..|:.:.|..|...|||:.:|
  Fly   131 LEFKLPAETTQQVARALDEG-----RGK------------IKKMLGPVALAIGAKLFAVIPLVLG 178

  Fly   190 ILKIKAFNALALGFFSFIVSVGLAIFQLC---------KKIAHDHHHTA-HITAHGPWDGRTFSS 244
            .|.:..|.|:.:...:|.:::.:...:|.         ...|..::..| ...|...|.....||
  Fly   179 FLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPASAGWSSGASSS 243

  Fly   245 VP-APVVEQPQKLGQALAY 262
            .| |..:.:.....|.|||
  Fly   244 YPYARSISEDGSDAQQLAY 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 20/120 (17%)
DUF3671 <152..216 CDD:289205 13/64 (20%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 21/128 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.