DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi13

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster

Alignment Length:111 Identity:27/112 (24%)
Similarity:45/112 (40%) Gaps:19/112 (17%)


  Fly   126 VNNQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGI 190
            |||.|            |....|.|||    .||.||  |.|:..|:|..:.:..:.::|:.:..
  Fly    80 VNNML------------ETWSTEGRGK----HKKQKK--LMKMVYPLLAAVAVAKVVLLPLILKW 126

  Fly   191 LKIKAFNALALGFFSFIVSVGLAIFQLCKKIAHDHHHTAHITAHGP 236
            |...:.::..:|..:.:.| |:...:......|.|.....|.:|.|
  Fly   127 LTALSTSSFVMGKIALVTS-GILALKWILSGGHAHDRLEIIHSHAP 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 13/37 (35%)
DUF3671 <152..216 CDD:289205 14/64 (22%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.