DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi12

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster


Alignment Length:307 Identity:60/307 - (19%)
Similarity:117/307 - (38%) Gaps:100/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVGVAALVAAGQAAGGSTEKM-------------QRLIAEEQNKCASGQDS-MACIKERAMRFVD 58
            ::.:.:::....:.|.:||::             .|.:....::|...:.. :.|:|::|:.|:|
  Fly    11 LISLLSVLFLASSCGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAISFID 75

  Fly    59 NVMSKDSFQVSNLEVRSNGEKTTPINEARASSADGFLDAIENYIRGHDVSMDLPLA----DAKVT 119
            .:...|:..|      :.|.|...:..|....|..     ||     ::...||.:    |||:|
  Fly    76 RLAPIDAINV------AEGIKLVRLETAPRPPATS-----EN-----ELESSLPRSGSDRDAKLT 124

  Fly   120 VSARNLVNNQLSL-----NLQ-----LNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILV 174
                |::..:||.     :||     |..|:...|.: |.|||            ::|:...:::
  Fly   125 ----NMLIERLSYFFNGHSLQVSFPKLTSDEIGRGLE-EGRGK------------MKKMMGMMMM 172

  Fly   175 LILLKAITVIPMAIGILKIKAFNALALGFFSFIVS--VGLAIFQLCKKIAHDHHHTAHI------ 231
            .:.:|.:.:||:|:|.|.|.|..||.:...:.:::  :||      ||:..........      
  Fly   173 GMAMKMMGMIPIAMGALYILAGKALIISKIALLLAGIIGL------KKLMSGKSSGGSSGWSSGG 231

  Fly   232 -------------TAHGPWDGRTFSSVPAPVVEQPQKLGQALAYQAY 265
                         ...|.||.|:.:.            .|.|||:|:
  Fly   232 GGGGGGWSSGGGGGGGGGWDRRSLTE------------AQELAYRAH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 27/119 (23%)
DUF3671 <152..216 CDD:289205 14/65 (22%)
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.