DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi10

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_731058.1 Gene:Osi10 FlyBaseID:FBgn0037417 Length:576 Species:Drosophila melanogaster

Alignment Length:242 Identity:50/243 (21%)
Similarity:99/243 (41%) Gaps:56/243 (23%)


  Fly    42 GQDSMACIKERAMRFVDNVMSKDS-FQVSN-LEVRSNGEKTTPINEARASSAD-GFLDAIENYIR 103
            |..::.|:...:.:.:|.....:| :|::: |.:    |....|::......| |....:...::
  Fly   342 GWQAVDCLGSESEQLLDGATRDNSTWQITDYLSI----EPKVGISKPETRRMDMGLPGKLLELVQ 402

  Fly   104 GHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDE-GTDVEARGKKGNIFKKGKKHRLRK 167
            |..:.:.||   .::|:|  |.::           |.|.| |.|   :|:|       ||.:.:.
  Fly   403 GRALRLQLP---RQLTIS--NAID-----------DFGSELGLD---QGRK-------KKDKDKN 441

  Fly   168 LAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVSVGLAIFQLCKKIAHDH------H 226
            :||...::::   .|:..|.:|.:.:.|.:|..:...:.::|    :....||.:..|      .
  Fly   442 MAMMGGMIMM---ATLAQMFLGKVILIAGSAFIMAKIALVIS----LLGSLKKGSTGHSGSGGGS 499

  Fly   227 HTAHITAHGPWDGRTFSSVPA-------PVVEQPQKLGQALA-YQAY 265
            .|.|:..|...:.....|:|.       ..||:| .||..:. ||||
  Fly   500 GTEHVVVHSSHESGWHRSMPTHDTYSQLDQVEEP-PLGSHMEYYQAY 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 23/110 (21%)
DUF3671 <152..216 CDD:289205 11/64 (17%)
Osi10NP_731058.1 DUF1676 42..203 CDD:311725
DUF1676 355..487 CDD:311725 32/169 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.