DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi19 and Osi7

DIOPT Version :9

Sequence 1:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:122/268 - (45%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VIVGVAALVA-------------AGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVD 58
            |..||..|||             |..|.||..:.|..:.::...|     ||::|:|.:...|||
  Fly     6 VTFGVLCLVALSAALPAEETRGHARNAIGGENDIMDSIYSDCLRK-----DSVSCVKYKLFSFVD 65

  Fly    59 NVM-SKDSFQVSN--LEVRSNGEKTTPINE-ARASSAD-GF----LDAIENYIRGHDVSMDLPLA 114
            .|: ::|.|.::.  ..|||   ...|..| ||:.|.| .|    |:.|.:::..|.:.::|..|
  Fly    66 KVLGARDQFALTEGVTVVRS---PDAPQQEAARSISGDESFESLALNRISSFLNSHTIKVELKGA 127

  Fly   115 DAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLK 179
            |....||:........|.:|   ....|.....|:||||    ||.     .|:..|||.|:.||
  Fly   128 DIVQAVSSTGRALEDASESL---FGSNDPNAPEESRGKK----KKA-----AKILGPILALVALK 180

  Fly   180 AITVIPMAIGILKIKAFNALALGFFSFIVSVGLAIFQLCKK--------IAHDHHHTAHITAHGP 236
            |..::|:.:|.:.:.|..||.:|..:.::|..:.:.:|..:        :||.||.::|.|:|..
  Fly   181 AAALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQEKHVTYEVVAHPHHSSSHSTSHDS 245

  Fly   237 WDGRTFSS 244
            : |..:|:
  Fly   246 Y-GSGYSA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 33/114 (29%)
DUF3671 <152..216 CDD:289205 19/63 (30%)
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 54/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.