DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi6

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster

Alignment Length:239 Identity:52/240 (22%)
Similarity:98/240 (41%) Gaps:64/240 (27%)


  Fly     2 AKLLLVIVGVAA--LVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIK----ERAMRFVDN- 59
            |.:||:..|::|  :.||.:..|...:.::             .||::|::    .:|....|| 
  Fly    34 ACILLLAAGISADPVKAAEEQPGAFAQCLE-------------SDSISCLQLTLFRKAKSVFDNP 85

  Fly    60 ----------VMSKDSFQVSNLEVRSNGEKTTPINEAR-ASSADGFLDAIENYIRGHDVSMDLPL 113
                      |.|.:..|..:|: .|...:..|..||| |...:.|:|..:::..  :.|::...
  Fly    86 QIELFGGVSLVKSNEGRQGKSLD-NSLAVEAAPTVEARTAEMGNYFMDNAKSFFA--ERSLNFNF 147

  Fly   114 ADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILL 178
            |:|..:| ||.:.:                  |::|..::..:..:.:|.:|.|..:|||:.:..
  Fly   148 ANAARSV-ARAIPD------------------DIKADLRELVVESRTRKKKLLKKFLPILLGVGA 193

  Fly   179 K-AITVIPMAIGIL----------KIKAFNALALGFFSFIVSVG 211
            | |:..:....|:|          .|..|.|||.|..|.:..:|
  Fly   194 KIAVLGVGSIFGLLFLAKKALVVSVIAFFLALAAGASSGLGRIG 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 23/118 (19%)
DUF3671 <152..216 CDD:289205 18/72 (25%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.