DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi5

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster

Alignment Length:247 Identity:54/248 (22%)
Similarity:91/248 (37%) Gaps:70/248 (28%)


  Fly    31 LIAEEQNKCASGQDSMA---CIKERAMRFVDNVM------SKDSFQVSNLEV---RSNGEKTTPI 83
            |.|.....|  .||:.|   |..|||:|   ||:      .|....:..||:   ::|.     |
  Fly    13 LTAVRSENC--DQDAGATLYCRGERALR---NVLRNLNRSDKPLVVIRGLEIVPLQNNS-----I 67

  Fly    84 NEARASSADGFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVE 148
            ::.......|.||::..|:|.|::  ::.|||.                 |:      ||....|
  Fly    68 SDEEPDQEQGLLDSLSFYLRTHEI--NVKLADL-----------------LE------DESQVSE 107

  Fly   149 ARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVSVGLA 213
            ||       ||.|...:      :|.:.|:....:..|.:|.:...|..||.:...:.:::..|.
  Fly   108 AR-------KKDKGQGM------LLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLG 159

  Fly   214 IFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPVVEQPQKLGQALAYQAY 265
            :....:......|..:::|..|....|...|..    :||      |||:.:
  Fly   160 LKTAAQHGGESSHSISYVTGEGHHHKRRRRSSG----QQP------LAYRGW 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 25/115 (22%)
DUF3671 <152..216 CDD:289205 11/64 (17%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 23/109 (21%)
RCR 184..>201 CDD:304939 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.