DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi4

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster

Alignment Length:167 Identity:41/168 (24%)
Similarity:61/168 (36%) Gaps:56/168 (33%)


  Fly    93 GFLDAI-ENYI------------RGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDD---- 140
            ||:|.: ||.|            |..|.|..:.:|..|.|.|:..        .||:||..    
  Fly   114 GFMDFVTENAIRVPVGPMVFSVQRAEDDSDYIEVALLKKTSSSTG--------RLQVNGGGLLGG 170

  Fly   141 ---------------GDEGTDVEARGKKGNIFKKGKKHRLR-KLAMPILVLILLKAIT-----VI 184
                           |..|.|   .|..|.:....::|:.: |....:.:.:.|.|.|     |.
  Fly   171 GGGLGGNGGGGGGLLGGGGGD---NGGGGGLLGGRRRHQHQDKKQFQMFIPMYLAATTFGWTMVA 232

  Fly   185 PMAIGILKIKAFNALALGFFSFIVSVGLAIFQLCKKI 221
            ..|:|:|.:|   ||.|...:|:|    |...|.||:
  Fly   233 AKAVGLLTLK---ALILSKIAFVV----AAIVLIKKL 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 22/102 (22%)
DUF3671 <152..216 CDD:289205 17/70 (24%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.