DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi19 and Osi21

Sequence 1:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster

Alignment Length:255 Identity:56/256 (22%)
Similarity:89/256 (35%) Gaps:72/256 (28%)


  Fly    18 GQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSFQVSN---LEVRSNGE- 78
            |.|.|...|  ..|:....:.|....|.:.|:|::|:..:...:.:||.::.:   ||.::..| 
  Fly    42 GTAWGLGPE--MALVRRVYDDCQDKNDFIGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSET 104

  Fly    79 --------------KTTPINEARASSADGFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQ 129
                          ..:||:.|..|.||       ..:|.|.:.:|:.:.               
  Fly   105 ESILGSLTDARQFGNLSPIDRALLSKAD-------KLMRTHTLKIDMDVG--------------- 147

  Fly   130 LSLNLQLNGDD--GDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILK 192
                   .|:|  |.|....:.:.|:|...|             .:|..||.|:.:    .|.|.
  Fly   148 -------GGEDSVGREHGHKKKKHKEGGHIK-------------YVVAALLTAMGI----AGPLG 188

  Fly   193 IKAFNALALGFFSFIVSVGL---AIFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPV 249
            :||..|:| |....|..|.|   .|..|.|..:|||........|.....|..:.|..||
  Fly   189 LKALAAIA-GKALVISKVALTIAGIIALKKLFSHDHSEETSFQVHAGEHNRRNTYVIRPV 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 21/126 (17%)
DUF3671 <152..216 CDD:289205 18/67 (27%)
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 16/102 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.