DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi23

DIOPT Version :10

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:128 Identity:27/128 - (21%)
Similarity:39/128 - (30%) Gaps:44/128 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 ALTDFTFMVRDTSYLFITGPDVVKAVTNEEVTQEELGGAKTHTVTSGVAHGAFDNDVDALMSLRE 255
            |.:|..|:|           |:|..:......|..:.|  .....:.:|...|..:.......||
  Fly    24 AASDSKFVV-----------DIVNRLEERNRLQVPIDG--VDRTPANLAPPFFGEEAFVWSRFRE 75

  Fly   256 LFNYLPLSNTDAAPIRAAEDPWDRAVPSLDTVVPLESTAAYNMKDVVHALVDEGDFFEIMPDY 318
            .|:  ||:|          |..|..||:.|.                   .|..|.||..|:|
  Fly    76 QFH--PLAN----------DMEDATVPTADK-------------------PDGFDNFETQPNY 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 43..187 CDD:462310
Osi23NP_651794.2 DUF1676 44..207 CDD:462310 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.