DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi20

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649641.1 Gene:Osi20 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster

Alignment Length:319 Identity:67/320 (21%)
Similarity:128/320 (40%) Gaps:88/320 (28%)


  Fly     2 KSTA----ACLIVALAALSTAHSAPTEGQVAPQ--SATQLALDMYHGCLKDLSVSCVRPKALQWF 60
            :||:    .|.::.:|:.|.: .|..|..|.|:  |:.:|...:...|....::.|::.|.|.:.
  Fly     4 RSTSLLAFGCALLLVASTSVS-GAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYL 67

  Fly    61 NSALRQPEVRITERLSIVRTAEKVESRSMNP---EERLFDDIDSYLGSHSLRIQAPEYFRTSEAR 122
            :              ::....|:|..|::..   ::.:.|.:...|.::.:|:|.|:.|......
  Fly    68 D--------------TVANVEEEVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGSVV 118

  Fly   123 SLVPD--FLMSNPLTQGGLVPLAAANEGRGMIR---KAVLPFLLGLKLKTTVLVPLALGLIALKT 182
            :...|  |.:..|           .:|||...:   |..||.||.:|.|..|::|:.|.||.||.
  Fly   119 TYRSDRGFDLELP-----------KDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKA 172

  Fly   183 WKAMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIEH 247
            .||:.|..:::.|....:|:.:.: |:...::        ::||  :...||.. |:.||     
  Fly   173 TKALILSKIAIKLVLGFLIYNLIQ-KLGGMKM--------NMVP--MPAPVPAS-EYGVP----- 220

  Fly   248 IVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHAWARSSQEPQ---DAQDLAYA 303
                                        ...:.::||.:|...|..|.   |:|:|||:
  Fly   221 ----------------------------STTASSYDPSSWEPMSGGPYARWDSQNLAYS 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 17/106 (16%)
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 15/79 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2B2N3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.