DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi19

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster

Alignment Length:242 Identity:60/243 (25%)
Similarity:114/243 (47%) Gaps:36/243 (15%)


  Fly     8 LIVALAALSTAHSAPTEGQVA---PQSATQLALDMYHGCLKDL-SVSCVRPKALQWFNSALRQPE 68
            :||.:|||..|      ||.|   .:...:|..:..:.|.... |::|::.:|:::.::.:.:..
  Fly     7 VIVGVAALVAA------GQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDS 65

  Fly    69 VRITERLSIVRTAEKV----ESRSMNPEERLFDDIDSYLGSHSLRIQAP--EYFRTSEARSLVPD 127
            .::: .|.:....||.    |:|:.:.:..| |.|::|:..|.:.:..|  :...|..||:||.:
  Fly    66 FQVS-NLEVRSNGEKTTPINEARASSADGFL-DAIENYIRGHDVSMDLPLADAKVTVSARNLVNN 128

  Fly   128 FLMSNPLTQGGLVPLAAANEGRG------------MIRKAVLPFLLGLKLKTTVLVPLALGLIAL 180
            .|..|....|.........|.||            .:||..:|.|:.:.||...::|:|:|::.:
  Fly   129 QLSLNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKI 193

  Fly   181 KTWKAMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPH 227
            |.:.|:.||..|.::|..|.||::.|      ::.|..||..|:..|
  Fly   194 KAFNALALGFFSFIVSVGLAIFQLCK------KIAHDHHHTAHITAH 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 24/116 (21%)
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 22/108 (20%)
DUF3671 <152..216 CDD:289205 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.