DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi17

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001262307.1 Gene:Osi17 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster

Alignment Length:369 Identity:79/370 (21%)
Similarity:130/370 (35%) Gaps:90/370 (24%)


  Fly    15 LSTAHSAPTE---GQVAPQSATQLAL--------DMYHGCLKDL----SVSCVRPKALQWFNSAL 64
            |..|...||.   .::||..:..|.|        :::.|.::|.    .|||.:.....:.::.|
  Fly   120 LINATKFPTRKPMDKMAPSDSLLLRLARRFASGNELWDGLVRDCYLKPDVSCFQKNVFSYLDNVL 184

  Fly    65 RQPEVRITERLSIVRT----------AEKVESRSMNPEERLFDDIDSYLG-------SHSLRIQA 112
            ...:|.:|:||...:.          .|..|:|:.:.|..:.:...:..|       :|.|.:..
  Fly   185 DVQDVNVTQRLKFFKNQVDYQVDKEKEEHSEARAASAETPIEEVTSALYGKSIKFAMTHDLEVDL 249

  Fly   113 PEYFRTSEARSLVPDFLMSNP-LTQGGLVP--LAAANEGRGMIRKAVLPFLLG------------ 162
            ||.........:.|..:..|. :.:..|:|  :..|.....:|:|.:..||..            
  Fly   250 PEVMFNGATFRISPRAIEGNGIIAKLELIPKQVVKARLAGAIIQKKIQKFLRSKLVLSFLALLLI 314

  Fly   163 ---LKLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHV 224
               :|:|...|:|:.:|:.|.   |.:.|..|..:......:||:......:|......||..|:
  Fly   315 IKIIKIKLFWLLPIVIGVGAA---KKLLLKFLLFLFPALSHLFKLCSHYQQSYHAPAKYHHHHHL 376

  Fly   225 VPHHIEHVVPHHI--EHVVPHHIE------------HIVPHHIDH-----HLE------------ 258
            :.||...|.|.|.  .|.||..|.            |..|.|..:     |.|            
  Fly   377 IDHHHTVVPPWHSGEHHSVPEIIYTHPPKGHPSAYLHGAPVHESYGPGFEHFEGAWENSGPGLGS 441

  Fly   259 HHI-DHHVDLPVEHIEHLEHPSPAWDP---HAWARSSQEPQDAQ 298
            .:| |.:....:|...|...|.||.|.   |||...:  .|.||
  Fly   442 EYIGDINRVAQIEENAHFFKPHPANDAGVLHAWGLGT--TQQAQ 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 21/118 (18%)
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181 16/90 (18%)
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.