DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi11

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster

Alignment Length:325 Identity:76/326 (23%)
Similarity:132/326 (40%) Gaps:64/326 (20%)


  Fly     1 MKSTAACLIVALAAL--STAHSAPTEGQVAPQSATQLAL-----DMYHGCLKDLSVS-CVRPKAL 57
            |:|....||..|.|.  :.|..||:...   |::|:..|     .:|..|.....|. |.:.:.:
  Fly     1 MESRLGLLIALLLAAFQAWAMEAPSNYN---QNSTESGLLRTVRHIYGQCAYSEDVFWCCKIQGV 62

  Fly    58 QWFNSALRQPEVRITERLSIVR----TAEKVESRSMNPEERLFD-DID----------------S 101
            :....||:.|::.|.:.:|:||    |.:....||...|.:|.: |::                :
  Fly    63 RLLGRALKVPQLGIVDGVSLVRRESFTQDTRSGRSSLLESQLSNRDLEHLSGKSLDALLLERFLN 127

  Fly   102 YLGSHSLRIQAPEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGM--IRKAVLPFLLGLK 164
            ::.||.|::..|...|..|..  |.|:|:.   ..|..:| |:.:|||..  .:|.:.||:..:.
  Fly   128 FVHSHQLQVNLPRLLRFGERN--VQDWLLH---VVGYFMP-ASESEGRKKKDDKKYLGPFIAAVL 186

  Fly   165 LKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKIA---KPKIVNYEVVHYPHHVDHVVP 226
            |||.:| .:|...||:...||:.:|.::|::|..:.:.|:.   ..:...||:|.:|.       
  Fly   187 LKTAIL-KMAYHSIAIVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHPQ------- 243

  Fly   227 HHIEHVVPHHIEHVVPHHIEHIVPHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHAWARSS 291
                  |.....:...|..|:....|........||..:.:.       :....||.||..|..|
  Fly   244 ------VQQSHTYSSSHQGEYDTGGHDGGSYHRSIDDEMMMQ-------DKAYQAWMPHVAASPS 295

  Fly   292  291
              Fly   296  295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 29/121 (24%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.