DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi10

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_731058.1 Gene:Osi10 FlyBaseID:FBgn0037417 Length:576 Species:Drosophila melanogaster

Alignment Length:203 Identity:46/204 (23%)
Similarity:79/204 (39%) Gaps:41/204 (20%)


  Fly    26 QVAPQSATQLALDM---YHGCLKDLSVSCVRPKALQWFNSALRQPEVRITERLSIVRTAEKVESR 87
            ||.....:.::|:.   ..|..|.....|:...||.:.........|:..|....|: :|....|
  Fly    15 QVIGSDFSAMSLEFKQCVRGSQKPKIGECLGRSALNFIQKLDESDNVKFVEDFVTVK-SETAAVR 78

  Fly    88 SM------NPEE--RLFDDIDSYLGSHSLRIQAPEYF--------RTSEARSLVPDFLMSNPLTQ 136
            |:      :|.:  .:.::..:.:|..|:.......:        .|::|.| |.:|::..    
  Fly    79 SLSNVLDTDPVDFRGILENAGAVMGQRSMEWHMDGLYPGLMFKIGPTADANS-VAEFVLDG---- 138

  Fly   137 GGLVPLAAANE----------GRGMIRKAVLPFLLGLKLKTTVLVPLALGLIALKTWKAMTLGLL 191
                  ||..|          ||.:.::.:||||||||.....||||....|.|...|::.|..|
  Fly   139 ------AAQGERQFGFEDPSTGRVLTKQYLLPFLLGLKFNLVALVPLIFAGICLLLKKSLFLVKL 197

  Fly   192 SLVLSGAL 199
            ::.:|..|
  Fly   198 AIYVSSFL 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 20/124 (16%)
Osi10NP_731058.1 DUF1676 42..203 CDD:311725 40/173 (23%)
DUF1676 355..487 CDD:311725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.