DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi9

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster

Alignment Length:318 Identity:79/319 (25%)
Similarity:128/319 (40%) Gaps:109/319 (34%)


  Fly     7 CLIVALAALSTAHSAPTEGQVAPQSATQLALDMYHGCLKDLSVSCVRPKALQWFNSALRQPEVRI 71
            ||...:|:.:.|.|       ...|....||.|...|.:...|.|::.:||.:|::  ...:||:
  Fly     6 CLFALIASTAAATS-------EADSLLTSALKMVKDCGERSMVLCMKERALHYFDA--ENGDVRL 61

  Fly    72 TERLSIVRTAEKVESRSMN----PEE----------RLFDDIDSYLGSHSLRIQAPEYFRTSEAR 122
            ||.:::|:|.|....||:|    |||          .|.:.:..:.|:|:|:.:.|:.......|
  Fly    62 TEGIALVKTDEIPVGRSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQR 126

  Fly   123 SLVPDFLMSNPLTQGGLVPLAAANEGRGM---IRKAVLPFLLGLKLKTTVLVPLALGLIALKTWK 184
            :|                     .|.||.   .:|.::|.|:..|||...|:|||:|.:||.::|
  Fly   127 AL---------------------EESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFK 170

  Fly   185 AMTLGLLSLVLSGALVIFKIAKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIEHIV 249
            |:.:|.::|:|||.:.:.|:.:.|..|||||.:||:                             
  Fly   171 ALVIGKIALLLSGIIGLKKLLESKKENYEVVAHPHY----------------------------- 206

  Fly   250 PHHIDHHLEHHIDHHVDLPVEHIEHLEHPSPAWDPHAWARS-SQEPQDAQDLAYAGQK 306
                    ||.                        |::.|| ..:...||.||||..|
  Fly   207 --------EHE------------------------HSYGRSLPSDDSQAQQLAYAAYK 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 25/115 (22%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.