DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi4

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:195 Identity:43/195 - (22%)
Similarity:74/195 - (37%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GGLVPLAAANEGRG----------------MIRKAVLPFLLGLKLKTTVLVPLALGLIALKTWKA 185
            |||:.....:.|.|                ..:..:..:|.......|::...|:||:.|   ||
  Fly   182 GGLLGGGGGDNGGGGGLLGGRRRHQHQDKKQFQMFIPMYLAATTFGWTMVAAKAVGLLTL---KA 243

  Fly   186 MTLGLLSLVLSGALVIFKI---AKPKIVNYEVVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIEH 247
            :.|..::.|::..::|.|:   |..|:: |:   :|....:::|:.:::          |.|...
  Fly   244 LILSKIAFVVAAIVLIKKLMDNASEKMM-YQ---FPEQTPYMMPYGMDY----------PLHGAE 294

  Fly   248 IVPHHIDHHLEHHIDHHV------DLPVEHIEH--LEHPSPAWDPHAWARSSQEPQDAQDLAYAG 304
            |.|......|     ||:      .|| .|..|  ||..|.....|:...||....:.|.||..|
  Fly   295 ISPEMYPSSL-----HHLAMAGGGQLP-GHPGHPGLESLSAESHLHSAQVSSDGSNNTQVLAALG 353

  Fly   305  304
              Fly   354  353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 5/36 (14%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.