DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi18 and Osi2

Sequence 1:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster

Alignment Length:309 Identity:74/310 (24%)
Similarity:121/310 (39%) Gaps:75/310 (24%)


  Fly    43 CL-KDLSVSCVRPKALQWFNSALRQPEVRITERLSIVRTAEKVESRSM-------NPEERLFDD- 98
            || .||| .|.:.:||..|:....:.:.::::...:||..| .:.||:       :.|.|..|| 
  Fly    91 CLGGDLS-ECFKTQALNTFDEIFFKDQYKLSDFARVVRLPE-TQQRSLLQEPFEYSEEPRGDDDE 153

  Fly    99 -----------IDSYLGSHSLRIQAPEYFRTS---EARSLVPDFLMSNPLTQGGLVPLAAANEGR 149
                       .:.::.|.:|.::.||....:   |||.:..|......|...|   ..|.:..|
  Fly   154 WNQLLKYGLRRAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGELDLIDDG---QRAGHFSR 215

  Fly   150 GMIRKAVLPFLLGL---KLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKIAKPKIVN 211
            ..::|.::|.||.|   |||..:.:|..||:..||    ..|||.::||.|....||:.:|    
  Fly   216 KKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLK----KILGLAAIVLPGLFAYFKLCRP---- 272

  Fly   212 YEVVHYPHHVDHVVPHHI------EHVVPHHIEHVVPHHIEHIVPHHIDHHLEHHIDHHVDLPVE 270
                  |..|.......:      ::..|.:    .|..:.....:|  || ||....|...|..
  Fly   273 ------PGGVGGAFGGGLSGLFGGKNTFPEY----NPQGVGAATYYH--HH-EHFEGGHGGAPGP 324

  Fly   271 HIEHLEHPS---PAWDPHAWARSSQEPQ------------DAQDLAYAG 304
            :  :.:.||   |..|.::.:...|:.|            |.|:.||.|
  Fly   325 Y--YRQEPSFAKPYTDYYSKSYQGQQVQGQQVGGNSVSFGDPQEAAYNG 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 23/120 (19%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.