DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi18 and Osi21

DIOPT Version :9

Sequence 1:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster


Alignment Length:244 Identity:52/244 - (21%)
Similarity:95/244 - (38%) Gaps:66/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSTAACLIVAL-AALSTAHSAPTEGQVAPQSAT---------------QLAL--DMYHGCL-KD 46
            ||.....|::|| |::|||.:.......|.:|||               ::||  .:|..|. |:
  Fly     1 MKRLEWLLLLALVASVSTAVTPRRRRHSAVESATTSSPGDWGTAWGLGPEMALVRRVYDDCQDKN 65

  Fly    47 LSVSCVRPKALQWFNSALRQPEVRITERLSIVR-TAEKVES-----------RSMNPEER-LFDD 98
            ..:.|::.|||...:.||.|..::|.:.|::.: ...:.||           .:::|.:| |...
  Fly    66 DFIGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSPIDRALLSK 130

  Fly    99 IDSYLGSHSLRIQAPEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGR--------GMIRKA 155
            .|..:.:|:|:|.                      :..||.........|.        |.|:..
  Fly   131 ADKLMRTHTLKID----------------------MDVGGGEDSVGREHGHKKKKHKEGGHIKYV 173

  Fly   156 VLPFLLGLKLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKI 204
            |...|..:    .:..||.|..:|....||:.:..::|.::|.:.:.|:
  Fly   174 VAALLTAM----GIAGPLGLKALAAIAGKALVISKVALTIAGIIALKKL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 20/118 (17%)
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 16/94 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.