DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi23

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster

Alignment Length:171 Identity:31/172 (18%)
Similarity:70/172 (41%) Gaps:26/172 (15%)


  Fly    40 SEESVALFGGLRIDRSESGRSFGASKAVESFEDRAE---------------RYLETHELNLSFSG 89
            |...::::.|:|:..:.:    ....|....::|.:               :.|.||.|.::...
  Fly    71 SSPEISIYDGVRLVAAPN----STDNATRPDDERKDLKHLTWFDQLAVSLAKGLTTHTLQVNLGK 131

  Fly    90 DEQDENSENEYTGRAMDESRSKRMK-KMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLA 153
            ..:...|.:......:..:|.:|.: .|::.::..:....|::|.:.|.::..:|.|||.::.:|
  Fly   132 LTERYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMA 196

  Fly   154 LILAGATFFKDLLAKKKEHITTAYITGSPL-----NADIVH 189
            |:||.....| .:|....|....::.|..|     ..|:.|
  Fly   197 LLLASINGLK-RVANNGLHYGLYHVPGEHLGGYYDRGDVSH 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 24/139 (17%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 13/96 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.