powered by:
                   
 
    
    
             
          
            Protein Alignment Osi15 and Osi20
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649636.1 | Gene: | Osi15 / 40771 | FlyBaseID: | FBgn0037424 | Length: | 214 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_649641.1 | Gene: | Osi20 / 40777 | FlyBaseID: | FBgn0037430 | Length: | 280 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 191 | Identity: | 49/191 - (25%) | 
          
            | Similarity: | 77/191 -  (40%) | Gaps: | 31/191 - (16%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     5 FVCVVLLASLVCGSMA---------LPSQDNTERDLV------NMLNRLDSEESVALFGGLRIDR 54|.|.:||.:....|.|         :.|.|.....:|      |.::.|..:....|.....::.
 Fly    11 FGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLDTVANVEE 75
 
 
  Fly    55 SESGRSFGASKAVESFEDRAERYLETHELNLS-----FSGDEQDENSENEY-------TGRAMDE 107..|||:.|.....:...||..|.|.|:|:.|.     |:|......|:..:       .|||
 Fly    76 EVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRA--- 137
 
 
  Fly   108 SRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDLLAK 168..|...|:.|||||.:|.|..|::.|:..:|...:.|||.:|.:|:.|.......:|:.|
 Fly   138 -EKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALILSKIAIKLVLGFLIYNLIQK 197
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR21879 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.