DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi19

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster

Alignment Length:271 Identity:68/272 (25%)
Similarity:114/272 (42%) Gaps:72/272 (26%)


  Fly     3 AKFVCVVL-LASLV-CGSMALPSQDNTERDLVNMLNRLDS-EESVALF--GGLR-IDRSESGRSF 61
            ||.:.|:: :|:|| .|..|..|.:..:|.:....|:..| ::|:|..  ..:| :|...|..||
  Fly     2 AKLLLVIVGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDSF 66

  Fly    62 GAS-------------------KAVESFEDRAERYLETHE------------------------- 82
            ..|                   .:.:.|.|..|.|:..|:                         
  Fly    67 QVSNLEVRSNGEKTTPINEARASSADGFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQLS 131

  Fly    83 LNLSFSGDEQDENSENEYTGR---AMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISL 144
            |||..:||:.||.::.|..|:   ...:.:..|::|:.:|:|:.:.||...|:.:...|:|..:.
  Fly   132 LNLQLNGDDGDEGTDVEARGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAF 196

  Fly   145 KALAISFLALILA-GATFFKDLLAKK--KEHITTAYITG---------SPLNADIVHSDWSRNGQ 197
            .|||:.|.:.|:: |...|:  |.||  .:|..||:||.         |.:.|.:|... .:.||
  Fly   197 NALALGFFSFIVSVGLAIFQ--LCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPVVEQP-QKLGQ 258

  Fly   198 AGAADLAYNHY 208
            |    |||..|
  Fly   259 A----LAYQAY 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 40/184 (22%)
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 19/106 (18%)
DUF3671 <152..216 CDD:289205 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.