DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi18

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649639.1 Gene:Osi18 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster

Alignment Length:140 Identity:41/141 (29%)
Similarity:61/141 (43%) Gaps:34/141 (24%)


  Fly    68 ESFEDRAERYLETHELNLSFSGDEQDENSE-----------NEYTG------RAMDESRSKRMKK 115
            |...|..:.||.:|.|.:  ...|....||           |..|.      .|.:|.|. .::|
  Fly    93 ERLFDDIDSYLGSHSLRI--QAPEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRG-MIRK 154

  Fly   116 MLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGA-TFFKDLLAKKKEHITTAYIT 179
            .:||.||.||||..|:|.:...:|...:.||:.:..|:|:|:|| ..||  :||.|         
  Fly   155 AVLPFLLGLKLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFK--IAKPK--------- 208

  Fly   180 GSPLNADIVH 189
              .:|.::||
  Fly   209 --IVNYEVVH 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 34/113 (30%)
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.