DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi13

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster

Alignment Length:214 Identity:47/215 (22%)
Similarity:86/215 (40%) Gaps:29/215 (13%)


  Fly     6 VCVVLLASLVC----GSMALPSQDNTERDLVNMLNRLDSEESVALFGGLRIDRSESGRSFGASKA 66
            :.:|:|..|:.    |:..||........:|..:.: |:|:..|.....|::|      ...|.|
  Fly     6 ISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQ-DAEQEAAAEERQRVER------HWLSMA 63

  Fly    67 VESFEDRAERYLETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKKMLLPLLLALKLKKAVV 131
            ...........|.|.|:|      ...|....|..|:   ..:.|::.||:.|||.|:.:.|.|:
  Fly    64 ETQLHSLITDDLSTEEVN------NMLETWSTEGRGK---HKKQKKLMKMVYPLLAAVAVAKVVL 119

  Fly   132 VKIMFTIIKFISLKALAISFLALILAGATFFKDLLAKKKEHITTAYI-TGSPLNADIVHSDWSRN 195
            :.::...:..:|..:..:..:||:.:|....|.:|:....|.....| :.:||...:..||.|.:
  Fly   120 LPLILKWLTALSTSSFVMGKIALVTSGILALKWILSGGHAHDRLEIIHSHAPLVKGLHASDLSSS 184

  Fly   196 GQAGAADLAYNHYGLAQPF 214
            |.:...        :.|||
  Fly   185 GSSWMP--------IRQPF 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 28/132 (21%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.